DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and CG8927

DIOPT Version :9

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:124 Identity:27/124 - (21%)
Similarity:37/124 - (29%) Gaps:46/124 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NVLRAEQQVNVDGFAYAVELDNSVNVQQKGDLNGEEWVVKGSQSWTSPENVPVSIQYIADANGYQ 85
            |:|| |||:              ...||..........:.|.|    |...|..:|....::..|
  Fly    90 NLLR-EQQL--------------AQAQQSQFQQAAAAFLAGQQ----PVEQPSPVQQFLQSDDSQ 135

  Fly    86 VVSANPP-----------LPTPPPIPEA----------------IQRSLEYIAAHPPSQ 117
            ..:..||           :|||...|.|                ::|.....||.||.|
  Fly   136 PAAILPPPSSRFPAERPSIPTPLNRPAAFNDFGIGRFENSQRFGLERPTPTAAAPPPPQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 7/49 (14%)
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.