powered by:
Protein Alignment Cpr47Eg and Cpr73D
DIOPT Version :9
Sequence 1: | NP_610661.1 |
Gene: | Cpr47Eg / 36196 |
FlyBaseID: | FBgn0086519 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097627.1 |
Gene: | Cpr73D / 39897 |
FlyBaseID: | FBgn0036680 |
Length: | 597 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 38/66 - (57%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 RAEQQVNVD-GFAYAVELDNSVNVQQKGDLNGEEWVVKGSQSWTSPENVPVSIQYIADAN-GYQV 86
:|..:::|. |.|.:.:|..|.:..::.:....:.:|:|:.|:...:.|..:::|||.|. ||:|
Fly 199 KARGKMSVQRGPAGSYKLIASGSDHRRAESRAPDGLVRGTYSFLDDKGVQRTVEYIAGAGIGYRV 263
Fly 87 V 87
|
Fly 264 V 264
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.