DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:122 Identity:44/122 - (36%)
Similarity:65/122 - (53%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFFIAFACLLAVALANEDANVLRAE-----QQVNVDG-FAYAVELDNSVNVQQKGDLNGEEWVVK 60
            |||:.....|||:....|:...|||     ..:..|| :||..:..|.:..|:.| :.|  :...
  Fly     3 KFFVLAVAALAVSCVQADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAGQESG-VGG--YYAS 64

  Fly    61 GSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAAHPPSQ 117
            ||.::.:|:...:.:.|.||:|||....|:  ||||||||.:|.:|||||..||..:
  Fly    65 GSNAYYAPDGQLIQLTYTADSNGYHPAGAH--LPTPPPIPASILKSLEYIRTHPQQE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 13/49 (27%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 13/49 (27%)

Return to query results.
Submit another query.