DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Acp65Aa

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:103 Identity:29/103 - (28%)
Similarity:53/103 - (51%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFI---AFACLLAVALA--NEDANVLRAE-QQVNVDGFAYAVELDNSVNVQQKGDLN-----G 54
            ||..:   :.|.|||:|.|  ..|..||..| :...:.|:.::.:|.:..:..::|.:|     .
  Fly     2 MKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66

  Fly    55 EEWVVKGSQSWTSPENVPVSIQYIADANGYQVVSANPP 92
            |...::||.:|.:|:....:|.::||.||:|...|:.|
  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 12/54 (22%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 12/54 (22%)

Return to query results.
Submit another query.