DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and l(3)mbn

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:108 Identity:22/108 - (20%)
Similarity:42/108 - (38%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAFACLLAVALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKGDLNGEEWVVKGSQSWTSPE 69
            :||.|  |:.|.....:||.|...|....|.:.::     ..|.:.:...|..::.|...:.:.:
  Fly     6 MAFVC--ALLLLCTLTHVLSAATTVRPYKFGFTID-----EQQHRAEKRDERGIIMGEFGFITAD 63

  Fly    70 NVPVSIQYIADANG-YQVVS------ANP------PLPTPPPI 99
            .:.....|..|..| ::::|      |.|      |:.|.|.:
  Fly    64 GIYHVTVYATDEEGKFRIISMKSYPYAGPVGSKSVPVTTTPKV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 7/50 (14%)
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.