DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Cpr49Ae

DIOPT Version :9

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster


Alignment Length:136 Identity:48/136 - (35%)
Similarity:71/136 - (52%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFIAFACLLAVAL----------ANEDANVLRAEQQVNVDG-FAYAVELDNSVNVQQKGDL-- 52
            ||.|.  .||||.||          |.|...::..|..:..|| :.||.|..|.:..::.|.|  
  Fly     1 MKNFA--LCLLATALMSCCQAAPQKAEEPIAIISQESNIEPDGSYNYAYETANGIKAEETGTLKK 63

  Fly    53 -----NGEEWVVKGSQSWTSPENVPVSIQYIA-DANGYQVVSANPPLPTPPPIPEAIQRSLEYIA 111
                 :.:..:.:||.|:||||...:::.|.| |.||:|  .....||||||||.|||::|:|:.
  Fly    64 ATSPDSSDVIIARGSVSYTSPEGNLITLNYSADDENGFQ--PQGDHLPTPPPIPPAIQKALDYLL 126

  Fly   112 AHPPSQ 117
            :.||::
  Fly   127 SLPPAK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 17/57 (30%)
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.