DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:80 Identity:23/80 - (28%)
Similarity:46/80 - (57%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LANEDANVLRAEQQVN--VDGFAYAVELDNSVNVQQKG-DLN----GEEWVVKGSQSWTSPENVP 72
            :|...|.::.....||  ...::|..|.:|.::.:::| .:|    .:|..|:|:.|:.:||.:.
  Fly    62 IAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLR 126

  Fly    73 VSIQYIADANGYQVV 87
            |.::|:|||||::.|
  Fly   127 VGVKYLADANGFRPV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 17/54 (31%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.