DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Lcp4

DIOPT Version :9

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:116 Identity:49/116 - (42%)
Similarity:61/116 - (52%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FFIAFAC-LLAVALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKGDLNGEEWVVKGSQSWT 66
            |.|...| |:|:..|||:..|......|..|||...:.|||.......||::|.   :.|...|.
  Fly     2 FKILLVCALVALVAANENPEVKELVNDVQADGFVSKLVLDNGSAASATGDVHGN---IDGVFEWV 63

  Fly    67 SPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAAHPPSQ 117
            |||...|.:.|.||.||||..|  ..|||||||||||.:::.||.|||..:
  Fly    64 SPEGEHVRVSYKADENGYQPQS--DLLPTPPPIPEAILKAIAYIQAHPSKE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 17/49 (35%)
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.