DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Pcp

DIOPT Version :9

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:121 Identity:46/121 - (38%)
Similarity:64/121 - (52%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFIAFACLLAVA----LANEDAN--VLRAEQQVNVDG-FAYAVELDNSVNVQQKGDLNGEEWV 58
            :.|.:|.|.|...|    :.:.|.|  .|:.:.||..|| :.||.|..|.::..|:| |.|.  .
  Fly     5 VNFIVALAVLQVQAGSSYIPDSDRNTRTLQNDLQVERDGKYRYAYETSNGISASQEG-LGGV--A 66

  Fly    59 VKGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIPEAIQRSLEYIAAHP 114
            |:|..|:||||...:|:.|:||..||..|.|:     .|.:|:.|.||||||..||
  Fly    67 VQGGSSYTSPEGEVISVNYVADEFGYHPVGAH-----IPQVPDYILRSLEYIRTHP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:278791 19/49 (39%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.