DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and Cpr11A

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster


Alignment Length:93 Identity:28/93 - (30%)
Similarity:45/93 - (48%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NVLRAE----QQVNVDGFAYAVEL--DNSVNVQQKGDLNGEE-WVVKGSQSWTSPENVPVSIQYI 78
            :|::|:    |..| .|..:.:||  .|.:.|...|.|..:: :||.||.|:|..:......:|.
  Fly    55 DVMKAKTETLQNYN-SGKKFKLELKTQNGIEVSSVGKLKDDKTFVVSGSYSFTGADGKRYKTRYT 118

  Fly    79 ADANGYQ-VVSANPPLPTPPPIPEAIQR 105
            ||..||. :...:..:|.|.|:..|.||
  Fly   119 ADEFGYHPITELDLDIPEPQPLASAGQR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 15/52 (29%)
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:459790 15/50 (30%)

Return to query results.
Submit another query.