DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr47Eg and LOC1271062

DIOPT Version :10

Sequence 1:NP_610661.1 Gene:Cpr47Eg / 36196 FlyBaseID:FBgn0086519 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_309807.4 Gene:LOC1271062 / 1271062 VectorBaseID:AGAMI1_006223 Length:322 Species:Anopheles gambiae


Alignment Length:95 Identity:39/95 - (41%)
Similarity:54/95 - (56%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLRAEQQVNVDG---FAYAVELDNSVNVQQKGDLNG-----EEWVVKGSQSWTSPENVPVSIQYI 78
            :||.|...|.||   |.||.  .|.:..|::|.|..     .|.||.|..|:|:|:....|:||.
Mosquito   122 ILRYENVNNGDGSYRFDYAT--GNGIQHQEEGFLRNLGPEKSEQVVSGGYSYTAPDGQLYSVQYK 184

  Fly    79 ADANGYQVVSANPPLPTPPPIPEAIQRSLE 108
            |||||:|.|..:  ||||||:|:|:|.:.:
Mosquito   185 ADANGFQPVGDH--LPTPPPLPQALQEAYD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr47EgNP_610661.1 Chitin_bind_4 34..84 CDD:459790 21/54 (39%)
LOC1271062XP_309807.4 Chitin_bind_4 135..190 CDD:459790 21/56 (38%)

Return to query results.
Submit another query.