DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CMD1

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_009667.1 Gene:CMD1 / 852406 SGDID:S000000313 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:53/151 - (35%)
Similarity:97/151 - (64%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRL 67
            :..:||.||||..::||..||....|||.:..:|.::|.:| .|.:.:: ::|::|:|.|.:.::
Yeast     1 MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEV-NDLMNEIDVDGNHQI 64

  Fly    68 EFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMI 132
            ||.||:.|.::.:...|.|   :||.|||:::||.|:|.|..:.||.:|..:.::||:.|:|.|:
Yeast    65 EFSEFLALMSRQLKSNDSE---QELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAEVDDML 126

  Fly   133 EEIDSDGSGTVDFDEFMEMMT 153
            .|: |||||.::..:|..:::
Yeast   127 REV-SDGSGEINIQQFAALLS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 53/147 (36%)
CMD1NP_009667.1 PTZ00184 1..145 CDD:185504 53/148 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.