DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and AT1G76640

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_177790.1 Gene:AT1G76640 / 843997 AraportID:AT1G76640 Length:159 Species:Arabidopsis thaliana


Alignment Length:137 Identity:39/137 - (28%)
Similarity:63/137 - (45%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEFVQLAAKFI 80
            |:..|...|..:.|.|..|.:....:.:|:....:..:..:...|.|..|.|:..||. |..|..
plant    23 LEAVFAYMDANRDGRISAEELKKSFKTLGEQMSDEEAEAAVKLSDIDGDGMLDINEFA-LLIKGN 86

  Fly    81 VEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDF 145
            .|..:|..::::.||||:|...|...|....||.:|.:|.:..|..:..:||:..|.:..|.:.|
plant    87 DEFTEEEKKRKIMEAFRMYIADGEDCITPGSLKMMLMKLGESRTTDDCKVMIQAFDLNADGVLSF 151

  Fly   146 DEFMEMM 152
            |||..||
plant   152 DEFALMM 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 39/137 (28%)
AT1G76640NP_177790.1 PTZ00184 17..158 CDD:185504 37/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.