DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CML23

DIOPT Version :10

Sequence 1:NP_476968.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_564874.1 Gene:CML23 / 842958 AraportID:AT1G66400 Length:157 Species:Arabidopsis thaliana


Alignment Length:139 Identity:44/139 - (31%)
Similarity:77/139 - (55%) Gaps:5/139 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEFVQLAAKFI 80
            ::|.|..||....|.|..:.:.|::..:.....::....::.|.|.|.:|.::.:|||.|   |.
plant    16 IKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFDLDGNGFIDLDEFVAL---FQ 77

  Fly    81 V--EEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTV 143
            :  :..:.:..::|:|||.|||...||.|..:.|..::|.|.::.:.|:...||.::||||.|.|
plant    78 ISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGEKCSIQDCQRMINKVDSDGDGCV 142

  Fly   144 DFDEFMEMM 152
            ||:||.:||
plant   143 DFEEFKKMM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_476968.1 PTZ00184 6..153 CDD:185504 44/139 (32%)
CML23NP_564874.1 PTZ00184 13..152 CDD:185504 44/139 (32%)

Return to query results.
Submit another query.