DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and AT1G32250

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:148 Identity:51/148 - (34%)
Similarity:79/148 - (53%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLE 68
            :.:.|..|||..|::.|.|||..|.||:....:..:||.:|........:.|||:.|...:|.:|
plant     5 VSKKLDEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKADTKSNGLVE 69

  Fly    69 FEEFVQLAAKFIV---EEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDI 130
            |.|||.|.:..::   :......:::|...||::|..|||:|..:.|...:.:|...||..||..
plant    70 FPEFVALVSPELLSPAKRTTPYTEEQLLRLFRIFDTDGNGFITAAELAHSMAKLGHALTVAELTG 134

  Fly   131 MIEEIDSDGSGTVDFDEF 148
            ||:|.||||.|.::|.||
plant   135 MIKEADSDGDGRINFQEF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 51/144 (35%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 51/145 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.