DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and AT1G21550

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_564143.1 Gene:AT1G21550 / 838756 AraportID:AT1G21550 Length:155 Species:Arabidopsis thaliana


Alignment Length:155 Identity:38/155 - (24%)
Similarity:72/155 - (46%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMG----QPFDRQI--------LDELI----DEVDEDKS 64
            |::.|.:.|..:.|.:..:.:..||..:|    .|.:.::        |||.:    |.|.:.|.
plant    11 LRRMFKTLDKNQDGLVTLDELLWILDKLGWAEHTPDELELIVGKQSLDLDEFLRFYYDAVLDSKG 75

  Fly    65 GRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKEL--DDQLTEQE 127
            .:...:         :|.::|||:.:    ||.::|..|:|||....|:::|:.|  :::....:
plant    76 SKKNID---------VVADNDEAIAR----AFNVFDVNGDGYISAEELRDVLERLGFEEEAKAWD 127

  Fly   128 LDIMIEEIDSDGSGTVDFDEFMEMM 152
            ...||...|.:..|.|||:||..|:
plant   128 CGRMIRVHDKNLDGFVDFEEFKNMI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 38/155 (25%)
AT1G21550NP_564143.1 FRQ1 8..154 CDD:227455 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.