DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and AT1G18530

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_173288.1 Gene:AT1G18530 / 838434 AraportID:AT1G18530 Length:157 Species:Arabidopsis thaliana


Alignment Length:145 Identity:46/145 - (31%)
Similarity:81/145 - (55%) Gaps:7/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRLEFEEFVQ 74
            :||..|:..|:.||....||:....:|.:||.:| :|...|| ..|:..:|.:.:|.:||:|   
plant     3 DQIRQLKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQI-HVLLASMDSNGNGFVEFDE--- 63

  Fly    75 LAAKFIVEEDDEAM--QKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDS 137
            |....:.:.::|.:  .::|.|.|:.:|:.|||:|..:.|...:.::...||.:||..||:|.|:
plant    64 LVGTILPDLNEEVLINSEQLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADT 128

  Fly   138 DGSGTVDFDEFMEMM 152
            :|.|.:.|.||..:|
plant   129 NGDGVISFGEFASIM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 46/145 (32%)
AT1G18530NP_173288.1 PTZ00184 2..143 CDD:185504 45/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.