DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CML43

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_199259.1 Gene:CML43 / 834473 AraportID:AT5G44460 Length:181 Species:Arabidopsis thaliana


Alignment Length:149 Identity:48/149 - (32%)
Similarity:76/149 - (51%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDE-VDEDKSGRLEFEEFV----QL 75
            |.:.|:.||....|.|..|.::..|..:|...|...|...:|. :..||:| |.|::|.    .|
plant    29 LHRVFDLFDKNNDGFITVEELSQALSRLGLDADFSDLKSTVDSFIKPDKTG-LRFDDFAALHKTL 92

  Fly    76 AAKFIVEED---DEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTE----QELDIMIE 133
            ...|...|.   |.:.:.:|.|||.::|:.|:|:|....|:::||:|.  |.|    ::::.||.
plant    93 DESFFGGEGSCCDGSPESDLEEAFNVFDEDGDGFISAVELQKVLKKLG--LPEAGEIEQVEKMIV 155

  Fly   134 EIDSDGSGTVDFDEFMEMM 152
            .:||:..|.|||.||..||
plant   156 SVDSNHDGRVDFFEFKNMM 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 48/149 (32%)
CML43NP_199259.1 PTZ00184 33..174 CDD:185504 45/143 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.