DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CML37

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_199053.1 Gene:CML37 / 834244 AraportID:AT5G42380 Length:185 Species:Arabidopsis thaliana


Alignment Length:152 Identity:46/152 - (30%)
Similarity:74/152 - (48%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRL 67
            |::|         |:..|:..|....|.|..|.:...:.|:|.....:.::|::...|.|..|.:
plant    46 NVNE---------LRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFI 101

  Fly    68 EFEEFVQLAAKFIVEED--DEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDI 130
            :||||:    |.:..||  ||..:|||:|||.:|..:|..:|..:.|:..|..|.:..|.....:
plant   102 DFEEFL----KLMEGEDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKV 162

  Fly   131 MIEEIDSDGSGTVDFDEFMEMM 152
            ||...|.:..|.:.||||:.||
plant   163 MIRGFDQNDDGVLSFDEFVLMM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 44/147 (30%)
CML37NP_199053.1 PTZ00184 47..184 CDD:185504 43/149 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.