DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Cabp4

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_036017598.1 Gene:Cabp4 / 73660 MGIID:1920910 Length:297 Species:Mus musculus


Alignment Length:145 Identity:53/145 - (36%)
Similarity:81/145 - (55%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRLE 68
            |.:|.||::..||.||..||..:.|.|....:.|.:|.:| .|.:.::| |:...|.....|.::
Mouse   119 DRELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELL-EVSQHVKMRMGGFVD 182

  Fly    69 FEEFVQLAAKFIVEEDDEAM-QKELREAFRLYDKQGNGYIPTSCLKEILKE-LDDQLTEQELDIM 131
            |||||:|.:..:.||....: .:|||.|||.:||..:|.|..:.|::.... |.:.|...|||.|
Mouse   183 FEEFVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEM 247

  Fly   132 IEEIDSDGSGTVDFD 146
            :.|:|.:|.||:|||
Mouse   248 LREMDLNGDGTIDFD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 52/142 (37%)
Cabp4XP_036017598.1 PTZ00184 133..262 CDD:185504 45/129 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.