DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CABP4

DIOPT Version :10

Sequence 1:NP_476968.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_660201.1 Gene:CABP4 / 57010 HGNCID:1386 Length:275 Species:Homo sapiens


Alignment Length:152 Identity:57/152 - (37%)
Similarity:88/152 - (57%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRLE 68
            |.:|.||::..||.||..||..:.|.|....:.|.:|.:| .|.:.::| |:...:.....||::
Human   123 DRELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELL-EVSQHIKMRMGGRVD 186

  Fly    69 FEEFVQLAAKFIVEEDDEAM-QKELREAFRLYDKQGNGYIPTSCLKEILKE-LDDQLTEQELDIM 131
            |||||:|....:.||....: .:|||.|||.:|:..:|.|..:.|:|.:.. |.:.|...|||.|
Human   187 FEEFVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEM 251

  Fly   132 IEEIDSDGSGTVDFDEFMEMMT 153
            :.|:|.:|.||||||||:.|::
Human   252 LREVDLNGDGTVDFDEFVMMLS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_476968.1 PTZ00184 6..153 CDD:185504 56/149 (38%)
CABP4NP_660201.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112
KLF9_13_N-like <56..101 CDD:425361
PTZ00184 125..274 CDD:185504 56/150 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.