DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and calml4a

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001124246.1 Gene:calml4a / 560151 ZFINID:ZDB-GENE-081022-9 Length:153 Species:Danio rerio


Alignment Length:153 Identity:44/153 - (28%)
Similarity:78/153 - (50%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDE-------DKSG 65
            |:..||...::.|:.:|.::.|.|..:.:..::|.:|       .....:|||.       ||:|
Zfish     5 LSQNQIDEFKECFSLYDKKRKGKIEAKDLITVMRCLG-------TSPTYNEVDRHLQVHKIDKTG 62

  Fly    66 RLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDI 130
            .|:|..|:.:..:.:.:||.:.   |:.||.|:.||...|||..|.|:..|..|.::||::|:|.
Zfish    63 ELDFSTFLTMMHRQMQQEDPKT---EILEAMRMTDKHKKGYIQASELRAKLTGLGEKLTDKEVDE 124

  Fly   131 MIEEIDSDGSGTVDFDEFMEMMT 153
            :.:|......|.|.::||..|:|
Zfish   125 LFKEAHVGRDGLVHYEEFTRMVT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 44/153 (29%)
calml4aNP_001124246.1 PTZ00184 1..147 CDD:185504 43/151 (28%)
EFh 12..74 CDD:238008 15/68 (22%)
EFh 85..147 CDD:238008 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.