DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and cetn3

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001018335.1 Gene:cetn3 / 552931 ZFINID:ZDB-GENE-050522-152 Length:167 Species:Danio rerio


Alignment Length:151 Identity:45/151 - (29%)
Similarity:89/151 - (58%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILD--ELIDEVDEDKSGRLEF 69
            :||.||...:::||..|...|...|....:...:|.:|  |:.:.:|  :::.:.|.:.:|::.|
Zfish    21 ELTDEQKDEIKEAFELFGTDKDKEIDYHELKVAMRALG--FEVKKVDVLKILKDYDREGTGKISF 83

  Fly    70 EEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEE 134
            |:|.::....|:|.|.   ::|:.:||:|:|....|.|....|:.:.:||.:.:::::|..||:|
Zfish    84 EDFREVVTDMILERDP---KEEILKAFKLFDDDETGKISLRNLRRVARELGEDMSDEDLRAMIDE 145

  Fly   135 IDSDGSGTVDFDEFMEMMTGE 155
            .|:||.|.::.|||:.:|||:
Zfish   146 FDTDGDGEINQDEFISIMTGD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 44/148 (30%)
cetn3NP_001018335.1 PTZ00183 13..167 CDD:185503 45/151 (30%)
EFh 29..91 CDD:238008 14/63 (22%)
EFh 102..164 CDD:238008 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.