DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CABP2

DIOPT Version :10

Sequence 1:NP_476968.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001305425.1 Gene:CABP2 / 51475 HGNCID:1385 Length:226 Species:Homo sapiens


Alignment Length:155 Identity:55/155 - (35%)
Similarity:92/155 - (59%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSG 65
            ::.|.:|.||:|..||.||..||..:.|.|....:...:|.:| .|.:.    |||:...:...|
Human    75 NSYDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEM----ELIEISQQISGG 135

  Fly    66 RLEFEEFVQL-AAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKE-LDDQLTEQEL 128
            :::||:||:| ..|.:.|..|....:|||:|||.:|..|:|.|....|:..||. |.::|:::|:
Human   136 KVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREV 200

  Fly   129 DIMIEEIDSDGSGTVDFDEFMEMMT 153
            |.:::::|.:|.|.|||:||:.||:
Human   201 DEILQDVDLNGDGLVDFEEFVRMMS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_476968.1 PTZ00184 6..153 CDD:185504 53/149 (36%)
CABP2NP_001305425.1 PTZ00184 80..224 CDD:185504 52/147 (35%)

Return to query results.
Submit another query.