DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Phf24

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006238183.1 Gene:Phf24 / 500446 RGDID:1559864 Length:400 Species:Rattus norvegicus


Alignment Length:96 Identity:20/96 - (20%)
Similarity:43/96 - (44%) Gaps:19/96 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNIDEDLTPEQIAVLQKAFNSFDHQKTGSIP--TEMVADILRLMGQ-----PFDRQILDELIDE- 58
            ||::..||.|::..|.:.|     |:...||  :..:.|.:|...|     ...|.:.||..:: 
  Rat   189 DNLNLLLTEEEMYSLTETF-----QRCKVIPDCSLTLEDFVRYRHQAAKRGDSTRALSDEQEEQA 248

  Fly    59 ------VDEDKSGRLEFEEFVQLAAKFIVEE 83
                  :|.:..|.:|:.:|:...:..::::
  Rat   249 ARQFAALDPEHRGHVEWPDFLSHESLLLLQQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 18/90 (20%)
Phf24XP_006238183.1 Zf_RING 127..198 CDD:407013 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.