DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and calml4

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001011117.1 Gene:calml4 / 496530 XenbaseID:XB-GENE-5936220 Length:153 Species:Xenopus tropicalis


Alignment Length:148 Identity:37/148 - (25%)
Similarity:77/148 - (52%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQ-PFDRQILDEL-IDEVDEDKSGRLEFE 70
            |:.:.|...::.|:.:|.:..|.||...:..::|.:|. |...::...| :.::.:|  |.::|.
 Frog     5 LSQDAIQKFKECFSLYDKKGKGKIPAGDLLTVMRCLGTCPTPGEVTRHLQVHKIGKD--GEVDFS 67

  Fly    71 EFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEI 135
            .|:.:..:...:||.|   .|:..|..:.|||..|.||...|:..|.::.::||.:|:|.:::.:
 Frog    68 TFLTIMYRQQKQEDPE---NEIMVAMLMSDKQKKGVIPLKELRAKLTQMGEKLTPEEVDDLLKGV 129

  Fly   136 DSDGSGTVDFDEFMEMMT 153
            .....|.|.::||:..:|
 Frog   130 KVGPDGMVKYEEFVRQIT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 37/148 (25%)
calml4NP_001011117.1 PTZ00184 1..144 CDD:185504 36/143 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.