DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and cabp1a

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001315294.1 Gene:cabp1a / 449789 ZFINID:ZDB-GENE-041010-36 Length:379 Species:Danio rerio


Alignment Length:152 Identity:53/152 - (34%)
Similarity:93/152 - (61%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRLE 68
            :.:|.||:|..|:.||..||..|.|.|..:.:.:.:|.|| .|.:.::: ||..:::.:..|.::
Zfish   228 NRELRPEEIDELRDAFKEFDKDKDGFISCKDLGNCMRTMGYMPTEMELI-ELSQQINMNLGGHVD 291

  Fly    69 FEEFVQL-AAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKE-LDDQLTEQELDIM 131
            ||:||:| ..|.:.|..|....||||.||:.:|..|:|.|.|..|:|.::: |..|:..::|:.:
Zfish   292 FEDFVELMGPKLLAETADMIGIKELRNAFKEFDTNGDGEISTGELREAMRKLLGQQVGHRDLEDI 356

  Fly   132 IEEIDSDGSGTVDFDEFMEMMT 153
            :.:||.:|.|.|||:||:.|::
Zfish   357 LRDIDLNGDGRVDFEEFVRMVS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 53/149 (36%)
cabp1aNP_001315294.1 PTZ00184 230..377 CDD:185504 52/147 (35%)
EFh 238..341 CDD:238008 36/103 (35%)
EFh 315..378 CDD:238008 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.