DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CG10126

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:153 Identity:38/153 - (24%)
Similarity:67/153 - (43%) Gaps:31/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLM-GQPFDR-QILDELIDEVDEDKSGRLEF 69
            |::.|:|   ::.|.:||...:|||  .|...:|:|. ..|..| .|:|:..:::|.|:.|.:..
  Fly    92 DVSEEEI---KQMFATFDEDGSGSI--NMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGVITI 151

  Fly    70 EEFVQLAAKFIVEEDDEAMQKELREAFRLYD-----KQGNGYIPTSCLKEILKELDDQLTEQELD 129
            ::   |...:.|:|..:....|..|...|.|     :.|.|            .||.::|.:|..
  Fly   152 QD---LKNVYSVKEHPKYQSGEKSEDEILTDFLHNFEGGRG------------NLDGKITREEFV 201

  Fly   130 IMIEEIDSDGSGTVDFDEFMEMM 152
            .....|    |.::|.|.|.::|
  Fly   202 NYYATI----SASIDNDMFFDLM 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 37/152 (24%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 10/31 (32%)
EFh 64..119 CDD:238008 10/31 (32%)
EFh 97..154 CDD:238008 17/64 (27%)
EF-hand_7 98..158 CDD:290234 18/67 (27%)
EF-hand_7 134..204 CDD:290234 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.