DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CG31345

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_731744.1 Gene:CG31345 / 41576 FlyBaseID:FBgn0051345 Length:213 Species:Drosophila melanogaster


Alignment Length:96 Identity:25/96 - (26%)
Similarity:46/96 - (47%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ELIDEVDEDKSGRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKE 118
            ||.:.:|:|...:|..:.|.:.|...:          .|..:||:.|..|:..:.....|:.:.:
  Fly    20 ELANGLDKDPIYKLRLQCFSRGATGIL----------GLSRSFRVMDDDGSKSLSPEEFKKGVTD 74

  Fly   119 LDDQLTEQELDIMIEEIDSDGSGTVDFDEFM 149
            :...||:.|:|.|....|:||||.::..||:
  Fly    75 IGLDLTDSEIDEMFSRFDTDGSGNINMTEFL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 25/96 (26%)
CG31345NP_731744.1 EF-hand_7 48..105 CDD:290234 17/56 (30%)
EFh 48..105 CDD:238008 17/56 (30%)
EFh 83..136 CDD:238008 10/23 (43%)
EF-hand_7 84..144 CDD:290234 9/22 (41%)
EF-hand_7 120..190 CDD:290234
EFh 120..187 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451866
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.