DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and tnnc2

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_012827046.1 Gene:tnnc2 / 394554 XenbaseID:XB-GENE-480259 Length:163 Species:Xenopus tropicalis


Alignment Length:147 Identity:55/147 - (37%)
Similarity:95/147 - (64%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEF 72
            |:.|.||..:.||:.||....|.|.|:.:..::|::||...::.||.:|:|||||.||.::||||
 Frog    15 LSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEF 79

  Fly    73 VQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDS 137
            :.:..:.:.|:.....::||.|.||::||..:|||....|.|||:...:.:|::|::.::::.|.
 Frog    80 LVMMVRQMKEDAQGKSEEELAECFRIFDKNADGYIDGEELAEILRSSGESITDEEIEELMKDGDK 144

  Fly   138 DGSGTVDFDEFMEMMTG 154
            :..|.:|||||::||.|
 Frog   145 NNDGKIDFDEFLKMMEG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 55/147 (37%)
tnnc2XP_012827046.1 PTZ00184 15..159 CDD:185504 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.