DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and cabp5a

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_956992.1 Gene:cabp5a / 393671 ZFINID:ZDB-GENE-040426-1655 Length:165 Species:Danio rerio


Alignment Length:153 Identity:55/153 - (35%)
Similarity:96/153 - (62%) Gaps:4/153 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRL 67
            ||.:|..::|..|::|||.||..|.|.|..:.:.:::|.|| .|.:.::: ||...::.:..||:
Zfish    12 IDRELADDEIEELREAFNEFDKDKDGLISCKDLGNLMRTMGYMPTEMELI-ELGQNINMNLGGRV 75

  Fly    68 EFEEFVQL-AAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLK-EILKELDDQLTEQELDI 130
            :||:||:| ..|.:.|.......||||:||:.:|..|:|.|.|..|: .:.|.|.:.:..:|:|.
Zfish    76 DFEDFVELMTPKLLAETAGMIGVKELRDAFKEFDMDGDGAITTEELRCAMTKLLGEHMNRREIDA 140

  Fly   131 MIEEIDSDGSGTVDFDEFMEMMT 153
            ::.|.|::|.|||||:||::|::
Zfish   141 VVREADNNGDGTVDFEEFVKMLS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 53/149 (36%)
cabp5aNP_956992.1 PTZ00184 15..164 CDD:185504 53/150 (35%)
EFh 23..85 CDD:238008 22/62 (35%)
EFh 100..163 CDD:238008 26/62 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.