DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Y73C8B.5

DIOPT Version :10

Sequence 1:NP_476968.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001256021.2 Gene:Y73C8B.5 / 3896865 WormBaseID:WBGene00044525 Length:116 Species:Caenorhabditis elegans


Alignment Length:85 Identity:18/85 - (21%)
Similarity:40/85 - (47%) Gaps:16/85 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 EDDEAM----------------QKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIM 131
            :|:||:                ::..::.|:.:|:.|||:|..:.|:.:......:|:.:.:...
 Worm    24 QDNEALGELTGAMLSLRGLAQSEENFKKVFQEFDEDGNGFISVAELEPLFSNFQARLSAEGIRKT 88

  Fly   132 IEEIDSDGSGTVDFDEFMEM 151
            ....|.|.:|.||.||.:::
 Worm    89 FRYTDIDRNGQVDLDELIDV 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_476968.1 PTZ00184 6..153 CDD:185504 18/85 (21%)
Y73C8B.5NP_001256021.2 EFh 49..107 CDD:238008 15/57 (26%)

Return to query results.
Submit another query.