DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CG13898

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:150 Identity:33/150 - (22%)
Similarity:74/150 - (49%) Gaps:7/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSG 65
            |::.|..|..:.:..:.:||...|.:|||.|..:.:.:::|.:||......:....:.::.|.:|
  Fly     1 MESQDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNG 65

  Fly    66 RLEFEEFVQLAAKFIVEEDDEAMQKE--LREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQEL 128
            .::..:|:.|..|..     .||...  |:.|:..:|...:|.:....|:.:...|.::::::|.
  Fly    66 YIQLTDFIDLMTKIY-----SAMGSSDYLKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEF 125

  Fly   129 DIMIEEIDSDGSGTVDFDEF 148
            :.:..:.|.||.|.::|.:|
  Fly   126 NEVFRQADVDGDGVINFRDF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 30/142 (21%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 30/142 (21%)
EFh 18..77 CDD:298682 14/58 (24%)
EFh 88..148 CDD:238008 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.