DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Caps2

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_006241399.1 Gene:Caps2 / 366891 RGDID:1309826 Length:589 Species:Rattus norvegicus


Alignment Length:151 Identity:39/151 - (25%)
Similarity:68/151 - (45%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FNSFDHQKTGSIPTEMVAD-ILRLMGQPFDRQILDELIDEVDEDKSGR---LEFEEFVQLAAKFI 80
            |.|.||.   |:|..:..: :|||.....|:..||.|  :....:.||   :..|...||..:.|
  Rat   345 FLSCDHP---SLPKSIKENALLRLRITSIDQVALDSL--KAASAEPGREDPVSQEAQDQLVLQAI 404

  Fly    81 VEEDDEAMQKE-------LREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELD----IMIEE 134
            .|:..|.:..:       |.:.|:..||:|||.:..:..::.|:....:::||:.:    |::..
  Rat   405 QEKLKEQLHTKGVRILTGLGKYFQRLDKEGNGLLEKTDFQQALETFHLEVSEQDFESSWLILLGH 469

  Fly   135 IDSDGSGTVDFDEFMEMMTGE 155
            ..|...  ||:.||...:.||
  Rat   470 GHSQNK--VDYGEFKRAIFGE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 37/149 (25%)
Caps2XP_006241399.1 EF-hand_7 423..485 CDD:290234 16/63 (25%)
PTZ00183 482..>574 CDD:185503 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.