powered by:
Protein Alignment TpnC47D and Spata21
DIOPT Version :9
Sequence 1: | NP_001286310.1 |
Gene: | TpnC47D / 36195 |
FlyBaseID: | FBgn0010423 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038966414.1 |
Gene: | Spata21 / 366491 |
RGDID: | 1302954 |
Length: | 692 |
Species: | Rattus norvegicus |
Alignment Length: | 74 |
Identity: | 23/74 - (31%) |
Similarity: | 36/74 - (48%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 EEDDEAMQKELREAFRLYDK--QGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVD 144
|..:|.:..:..||||.|.. .|.|.:....||.||..:....|..:::..:...|.:|.|.||
Rat 432 ERTEEHLTLKQEEAFRSYFDIFNGPGEVDARSLKNILLLIGFTFTPAQVEEALMSADVNGDGHVD 496
Fly 145 FDEFMEMMT 153
|.:|:.:||
Rat 497 FKDFLAVMT 505
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166342436 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.