DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Cabp5

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001102377.1 Gene:Cabp5 / 365194 RGDID:1308108 Length:173 Species:Rattus norvegicus


Alignment Length:154 Identity:51/154 - (33%)
Similarity:90/154 - (58%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGR 66
            |.|||         |::||..||..:.|.|..:.:.:::|.||.......|.||..::..:..||
  Rat    28 DEIDE---------LREAFLEFDKDRDGFISYKDLGNLMRTMGYMPTEMELTELGQQIRMNLGGR 83

  Fly    67 LEFEEFVQL-AAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKE-LDDQLTEQELD 129
            ::||:||:| ..|.:.|.......:|:|:||:.:|..|:|.|..:.|::.::. |.::||.:|:.
  Rat    84 VDFEDFVELMTPKLLAETAGMIGVQEMRDAFKEFDANGDGEITLAELQQAMQRLLGEKLTPREIA 148

  Fly   130 IMIEEIDSDGSGTVDFDEFMEMMT 153
            .:::|.|.:|.|||||:||::||:
  Rat   149 EVVQEADINGDGTVDFEEFVKMMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 47/148 (32%)
Cabp5NP_001102377.1 PTZ00184 25..171 CDD:185504 49/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.