DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Caps2

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_011241801.1 Gene:Caps2 / 353025 MGIID:2441980 Length:612 Species:Mus musculus


Alignment Length:157 Identity:38/157 - (24%)
Similarity:64/157 - (40%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TGSIPTEMVAD------------ILRLMGQPFDRQILDELIDEVDEDKSGRLEF--EEFV----- 73
            ||:..|.:..|            :|||.....|:..|:.|       |:...|.  ||.|     
Mouse   362 TGATLTFLSCDQPSLPKTIKENALLRLRITNIDQVALNSL-------KAASAEHGEEEAVSPEAH 419

  Fly    74 -QLAAKFIVEEDDEAMQKE-------LREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDI 130
             ||..:.|.::..|.:.|:       |...|:..||:|||.:..:..::.||....:::||:.:.
Mouse   420 DQLVLQAIQDKLKEQLHKKGARILTGLGRYFQGLDKEGNGLLEKADFQQALKTFHLEVSEQDFES 484

  Fly   131 --MIEEIDSDGSGTVDFDEFMEMMTGE 155
              :|.:........||:.||...:.||
Mouse   485 FWLILQGYGHSKNKVDYGEFKRAIFGE 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 36/155 (23%)
Caps2XP_011241801.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.