DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CG11638

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:151 Identity:55/151 - (36%)
Similarity:88/151 - (58%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEFVQLA 76
            |:...::||..||....|.|..|.:..::|.:||....:.|.|::.|:|.|..|.:.|||||.:.
  Fly   210 QMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVSFEEFVDIL 274

  Fly    77 AKFIVEE-------DDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEE 134
            :....|:       |.|  ::|||:|||::||...|||..|.|:.:|:.|.:.|.|::::.||:|
  Fly   275 SNMTYEDKSGLSSADQE--ERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEDIEDMIKE 337

  Fly   135 IDSDGSGTVDFDEFMEMMTGE 155
            :|.||.|.:||.||:..: ||
  Fly   338 VDVDGDGRIDFYEFVHAL-GE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 53/149 (36%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 21/61 (34%)
EF-hand_7 215..274 CDD:290234 21/58 (36%)
EFh 294..355 CDD:238008 28/60 (47%)
EF-hand_7 295..355 CDD:290234 27/59 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.