DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and Cabp1

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001297641.1 Gene:Cabp1 / 29867 MGIID:1352750 Length:350 Species:Mus musculus


Alignment Length:152 Identity:55/152 - (36%)
Similarity:94/152 - (61%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQILDELIDEVDEDKSGRLE 68
            |..|.||:|..|::||..||..|.|.|....:.:.:|.|| .|.:.::: ||..:::.:..|.::
Mouse   199 DRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELI-ELSQQINMNLGGHVD 262

  Fly    69 FEEFVQL-AAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKE-LDDQLTEQELDIM 131
            |::||:| ..|.:.|..|....||||:|||.:|..|:|.|.||.|:|.::: |..|:..::::.:
Mouse   263 FDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEI 327

  Fly   132 IEEIDSDGSGTVDFDEFMEMMT 153
            |.::|.:|.|.|||:||:.||:
Mouse   328 IRDVDLNGDGRVDFEEFVRMMS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 54/149 (36%)
Cabp1NP_001297641.1 PTZ00184 201..348 CDD:185504 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.