DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and cam1

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:54/149 - (36%)
Similarity:98/149 - (65%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEE 71
            :||.||||..::||:.||..:.|:|.:..:..::|.:||......|.::|:|||.|.:|.::|.|
pombe     5 NLTDEQIAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTE 69

  Fly    72 FVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEID 136
            |:.:.|:.:.:.|:|   :|:||||:::||.|||||....|..:|..|.::|:::|:..||.|.|
pombe    70 FLTMMARKMKDTDNE---EEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREAD 131

  Fly   137 SDGSGTVDFDEFMEMMTGE 155
            :||.|.::::||..:::.:
pombe   132 TDGDGVINYEEFSRVISSK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 54/146 (37%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 54/147 (37%)
EFh 13..75 CDD:238008 19/61 (31%)
EFh 86..148 CDD:238008 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.