DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and cam2

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:45/144 - (31%)
Similarity:80/144 - (55%) Gaps:15/144 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMG-QPFDRQIL---DELIDEVDEDKSGRLEFEE 71
            ||...:::||..:|..|.|.|||..|..:||.:| ...|.::.   :||.|.:||.|        
pombe     6 EQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNELGDAIDEKK-------- 62

  Fly    72 FVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEID 136
            |:...:..:.|.:.|   :|..:|||::||..:|||.|:...:.:|.|.::|::.|:.:|::|.|
pombe    63 FMSFVSNKLRETESE---EEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEAD 124

  Fly   137 SDGSGTVDFDEFME 150
            ...||:.|:.:|::
pombe   125 PTNSGSFDYYDFVQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 45/144 (31%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 45/144 (31%)
EFh 10..105 CDD:298682 32/105 (30%)
EFh 79..141 CDD:238008 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.