DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CG30378

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_724628.1 Gene:CG30378 / 246577 FlyBaseID:FBgn0050378 Length:148 Species:Drosophila melanogaster


Alignment Length:145 Identity:33/145 - (22%)
Similarity:86/145 - (59%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEF 72
            ||..||..:::||:.:|.:::|.:..:.:..::|.:|:......:.:|.:|.:.|..|:::|::|
  Fly     5 LTEAQIEEIREAFSLYDKERSGWVSVQQLGGVMRALGESLTEAEIYDLANESNADFGGQVQFKDF 69

  Fly    73 VQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDS 137
            :.:.:|.:.|::....   |::||:::|:........:.::.::..|.::::|::|..:.::||.
  Fly    70 LYVMSKRLEEQNSLVC---LKQAFKIFDRSEVNSFTINEIRMVMTNLGEKMSEEDLRELFQDIDQ 131

  Fly   138 DGSGTVDFDEFMEMM 152
            |..|.:.|:||:..|
  Fly   132 DKDGKISFNEFVTAM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 33/145 (23%)
CG30378NP_724628.1 PTZ00184 1..148 CDD:185504 33/145 (23%)
EFh 12..74 CDD:238008 12/61 (20%)
EFh 86..147 CDD:238008 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.