DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and K03A1.4

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001041263.2 Gene:K03A1.4 / 186916 WormBaseID:WBGene00019352 Length:184 Species:Caenorhabditis elegans


Alignment Length:143 Identity:40/143 - (27%)
Similarity:71/143 - (49%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEFVQL- 75
            :|...::|||.||....|.|..:.:...::..||...:..|..::...|.|::|.:.|:||..| 
 Worm    43 KIEEYKRAFNFFDANNDGRITIDELEKAMQKCGQKPTKLELRLIMYHGDNDQNGVITFDEFAHLM 107

  Fly    76 --AAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLT--EQELDIMIEEID 136
              .|..     ::....:|||.|.::||..:|:|....:..|::||..|.:  .|.::.:..|.|
 Worm   108 NGTASM-----NQYTYDQLREQFDMFDKDKDGFIEKMEMLSIVRELSLQASFPRQVVEQLFNEAD 167

  Fly   137 SDGSGTVDFDEFM 149
            .||.|.:.|:||:
 Worm   168 IDGDGKISFEEFV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 40/143 (28%)
K03A1.4NP_001041263.2 PTZ00184 43..180 CDD:185504 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.