DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and F43C9.2

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_508818.1 Gene:F43C9.2 / 180753 WormBaseID:WBGene00018376 Length:159 Species:Caenorhabditis elegans


Alignment Length:137 Identity:41/137 - (29%)
Similarity:64/137 - (46%) Gaps:3/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFEEFVQLAAKFI 80
            |.:.|:..|..|.|.:....:|.:||.:.....|..||.:..|:|.||:|::..||||.......
 Worm    24 LSETFDLLDVDKDGRLSRNEIAALLRTINVEPTRVELDFIFGEMDTDKTGKISKEEFVNYMKSPP 88

  Fly    81 VEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDF 145
            :.   ....:||...||.:|..|:|.|....:.|||:...|......:..|.:..|.:|.|.:.|
 Worm    89 IH---RTTLRELEVQFRKFDSDGDGAITEDEMAEILRRTADLGDRAAISDMFKATDLNGDGKITF 150

  Fly   146 DEFMEMM 152
            .||::||
 Worm   151 FEFVKMM 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 41/137 (30%)
F43C9.2NP_508818.1 EF-hand_7 24..84 CDD:290234 20/59 (34%)
EFh 25..85 CDD:298682 19/59 (32%)
EFh 96..158 CDD:238008 21/62 (34%)
EF-hand_7 101..157 CDD:290234 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.