DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and E02A10.3

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:147 Identity:43/147 - (29%)
Similarity:84/147 - (57%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDKSGRLEFE 70
            |..:.|::...::.||.||..::|:|..:.:...::.:|....|..||::|||||:..:.:::|:
 Worm   129 EGYSEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFD 193

  Fly    71 EFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEI 135
            ||..:..:..:::.:  ..:.::|.|.::|:..||.|.....:.||:||.|....|.:|.:..|.
 Worm   194 EFCVVMRRLTMKKSN--WNEVVKECFTVFDRSENGGISKKDFRFILRELGDITDNQIIDEIFNEA 256

  Fly   136 DSDGSGTVDFDEFMEMM 152
            |.||:|.:|:|||..|:
 Worm   257 DVDGNGVIDYDEFTYMV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 42/145 (29%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 41/142 (29%)
EF-hand motif 140..167 CDD:320054 6/26 (23%)
EF-hand motif 175..203 CDD:320054 10/27 (37%)
EF-hand motif 208..241 CDD:320054 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.