DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and cal-3

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:147 Identity:49/147 - (33%)
Similarity:89/147 - (60%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQ-PFDRQILDELIDEVDEDKSGRLEFEE 71
            ||.|:|...::||..||....|:|..:.:...:|.:|| |.::|:: |:|.:||.|.:|::||.|
 Worm    93 LTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMM-EIIHDVDLDGNGQVEFPE 156

  Fly    72 FVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEID 136
            |..:..:.:.|.|.|.    :||||:::|:.|||.|..:..|..:..:.....|.|::.|:.|:|
 Worm   157 FCVMMKRIMKETDSEM----IREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVD 217

  Fly   137 SDGSGTVDFDEFMEMMT 153
            .||:|.:|::||:::.:
 Worm   218 CDGNGEIDYEEFVKIFS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 49/147 (33%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 49/143 (34%)
EFh 100..162 CDD:238008 21/62 (34%)
EFh 172..234 CDD:238008 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.