DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and pat-10

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_491501.1 Gene:pat-10 / 172127 WormBaseID:WBGene00003934 Length:161 Species:Caenorhabditis elegans


Alignment Length:157 Identity:72/157 - (45%)
Similarity:101/157 - (64%) Gaps:3/157 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNIDE---DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILDELIDEVDEDK 63
            ::|:|   ::...||...||.|::||..|.|.|....:..|:..|.|.||.:.|.:||.:.|.|.
 Worm     3 EDIEEILAEIDGSQIEEYQKFFDAFDRGKQGYIMATQIGQIMHGMEQDFDEKTLRKLIRKFDADG 67

  Fly    64 SGRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQEL 128
            ||:|||:||..|........|.|.::|||||||||:||:|||||....||.:|||:.|.||:|:|
 Worm    68 SGKLEFDEFCALVYTVANTVDKETLEKELREAFRLFDKEGNGYISRPTLKALLKEIADDLTDQQL 132

  Fly   129 DIMIEEIDSDGSGTVDFDEFMEMMTGE 155
            :..::|||.||||.::|:||.|:|.||
 Worm   133 EEAVDEIDEDGSGKIEFEEFWELMAGE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 68/146 (47%)
pat-10NP_491501.1 EFh_PEF 16..156 CDD:330173 67/139 (48%)
EF-hand motif 21..47 CDD:320054 9/25 (36%)
EF-hand motif 55..94 CDD:320054 15/38 (39%)
EF-hand motif 95..124 CDD:320054 20/28 (71%)
EF-hand motif 131..156 CDD:320054 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5029
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 1 1.000 - - FOG0001548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.