powered by:
Protein Alignment TpnC47D and Caln1
DIOPT Version :9
Sequence 1: | NP_001286310.1 |
Gene: | TpnC47D / 36195 |
FlyBaseID: | FBgn0010423 |
Length: | 155 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006504429.3 |
Gene: | Caln1 / 140904 |
MGIID: | 2155987 |
Length: | 274 |
Species: | Mus musculus |
Alignment Length: | 76 |
Identity: | 33/76 - (43%) |
Similarity: | 46/76 - (60%) |
Gaps: | 5/76 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 AKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSG 141
|...|||.| |:|||||:.|:.|||:|....|...::.|....:|.||.|:::.:|.||.|
Mouse 86 ANISVEELD-----EIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDG 145
Fly 142 TVDFDEFMEMM 152
.|||||||.::
Mouse 146 QVDFDEFMTIL 156
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
TpnC47D | NP_001286310.1 |
FRQ1 |
8..155 |
CDD:227455 |
33/76 (43%) |
Caln1 | XP_006504429.3 |
PTZ00184 |
87..>197 |
CDD:185504 |
32/75 (43%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.