DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TpnC47D and Calb1

DIOPT Version :9

Sequence 1:	NP_001286310.1	Gene:	TpnC47D / 36195	FlyBaseID:	FBgn0010423	Length:	155	Species:	Drosophila melanogaster
Sequence 2:	NP_033918.1	Gene:	Calb1 / 12307	MGIID:	88248	Length:	261	Species:	Mus musculus

Alignment Length:	125	Identity:	40/125 - (32%)
Similarity:	63/125 - (50%)	Gaps:	13/125 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 KAFNSFDHQKTGSIPTE----MVADILRLMGQPFDRQILDELIDEV----DEDKSGRLEFEEFVQ 74
            |.:..:|...:|.|.||    .:.|:|....:..|...|.|..|.:    |.:..|:||..|..:
Mouse   105 KTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMAR 169

  Fly    75 L---AAKFIVE-EDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDI 130
            |   ...|::: :..:...||..:||.|||:.|||||..:.|..:||:|.:: .:|||||
Mouse   170 LLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEK-NKQELDI 228

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TpnC47D	NP_001286310.1	FRQ1	8..155	CDD:227455	40/125 (32%)
Calb1	NP_033918.1	Interaction with RANBP9. /evidence=ECO:0000250\|UniProtKB:P05937	2..7
		EFh_HEF	16..259	CDD:329015	40/125 (32%)
		EF-hand motif	16..44	CDD:320075
		EF-hand motif	57..86	CDD:320075
		EF-hand motif	102..131	CDD:320075	7/25 (28%)
		EF-hand motif	146..175	CDD:320075	7/28 (25%)
		EF-hand motif	190..219	CDD:320075	14/28 (50%)
		EF-hand motif	234..259	CDD:320075
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S5029
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950