DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC47D and CETN3

DIOPT Version :9

Sequence 1:NP_001286310.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001284694.1 Gene:CETN3 / 1070 HGNCID:1868 Length:191 Species:Homo sapiens


Alignment Length:175 Identity:48/175 - (27%)
Similarity:89/175 - (50%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQILD--ELIDEVDEDKSGRLEF 69
            :|:.||...::.||..||..|..:|....:...:|.:|  ||.:..|  :::.:.|.:.:|::.|
Human    21 ELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALG--FDVKKADVLKILKDYDREATGKITF 83

  Fly    70 EEFVQLAAKFIVEEDDEAMQKELREAFRLYDKQGNGYIPTSCLKEILKELDDQLTEQELDIMIEE 134
            |:|.::...:|:|.|.   .:|:.:||:|:|...:|.|....|:.:.:||.:.::::||..||||
Human    84 EDFNEVVTDWILERDP---HEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEE 145

  Fly   135 IDSDGSG------------------------TVDFDEFMEMMTGE 155
            .|.||.|                        .|:.:||:.:|||:
Human   146 FDKDGDGEILKNILLLPIWSRCLSLNREFFSEVNQEEFIAIMTGD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC47DNP_001286310.1 FRQ1 8..155 CDD:227455 47/172 (27%)
CETN3NP_001284694.1 PTZ00183 15..190 CDD:185503 47/173 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.